DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Spint2

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_035594.1 Gene:Spint2 / 20733 MGIID:1338031 Length:252 Species:Mus musculus


Alignment Length:55 Identity:21/55 - (38%)
Similarity:33/55 - (60%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACIPKK 129
            |:.....||||.:..|:||:.:..:|.:|.|||||||.|.:..::.|.:.|..|:
Mouse   133 CVPKAVTGPCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHCSGKQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 19/49 (39%)
Spint2NP_035594.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 131..183 CDD:438665 19/49 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.