DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Spint1

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_058603.2 Gene:Spint1 / 20732 MGIID:1338033 Length:507 Species:Mus musculus


Alignment Length:59 Identity:15/59 - (25%)
Similarity:23/59 - (38%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MHIDELWTDFVGNGCPSLIGKPK---LVFIQSCRGNKHDYLVGGAAVDAVPS-PEKPIC 155
            :|.:.:....|...|..:..:||   ..|...|.|..|..|.|.::.....| |:..||
Mouse    34 IHNNNIMRTAVDGPCLQITEQPKQRGFRFRYGCEGPSHGGLPGASSEKNRKSYPQVQIC 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 5/26 (19%)
Spint1NP_058603.2 MANEC 42..133 CDD:462186 14/51 (27%)
Kunitz_HAI1_1-like 239..297 CDD:438666
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.