DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Y49G5A.1

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_504413.1 Gene:Y49G5A.1 / 190090 WormBaseID:WBGene00021731 Length:182 Species:Caenorhabditis elegans


Alignment Length:57 Identity:19/57 - (33%)
Similarity:30/57 - (52%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PKCLQPLDVG--PCRMSLE--RFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            |:|..|||:|  ||:...:  |:::::.|.....|:|.||.||.|.:.....|...|
 Worm    23 PECKLPLDMGKTPCKNGKKEIRYHFDQKSNIPLAFEYSGCGGNKNNFKTESECRFTC 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 17/53 (32%)
Y49G5A.1NP_504413.1 Kunitz-type 25..79 CDD:438633 17/53 (32%)

Return to query results.
Submit another query.