DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and T22F7.3

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_497207.4 Gene:T22F7.3 / 188757 WormBaseID:WBGene00020702 Length:1517 Species:Caenorhabditis elegans


Alignment Length:51 Identity:20/51 - (39%)
Similarity:33/51 - (64%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            |.||..:|.|..::.|::||..:::||.|:|.||:||||.:.....|::.|
 Worm   533 CTQPKRLGDCTSAVRRYWYNAATRSCEMFQYTGCQGNDNNFNTLMACQQKC 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 19/49 (39%)
T22F7.3NP_497207.4 EB 144..199 CDD:460294
KU 311..365 CDD:197529
Kunitz_conkunitzin 446..486 CDD:438636
Kunitz_BPTI 533..584 CDD:425421 20/51 (39%)
Kunitz_BPTI 639..693 CDD:425421
Kunitz_BPTI 747..800 CDD:425421
Lustrin_cystein 804..850 CDD:464222
Lustrin_cystein 856..901 CDD:464222
Lustrin_cystein 1076..1119 CDD:464222
Lustrin_cystein 1123..1166 CDD:464222
EB 1218..1269 CDD:460294
EB 1295..1346 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.