DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and T21D12.12

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_499892.1 Gene:T21D12.12 / 188695 WormBaseID:WBGene00020651 Length:183 Species:Caenorhabditis elegans


Alignment Length:54 Identity:20/54 - (37%)
Similarity:30/54 - (55%) Gaps:3/54 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CLQPLDVG--PC-RMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            |....|.|  .| :.....||::|:::.|:.|.|.||.||.||:..::.||.||
 Worm    23 CFSARDTGNSGCGQQGARSFYFHKNTRTCQPFFYQGCDGNSNRFQSKEACESAC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 18/52 (35%)
T21D12.12NP_499892.1 Kunitz_BPTI 23..77 CDD:425421 20/54 (37%)
KU 127..182 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.