DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and C54D10.10

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:61 Identity:21/61 - (34%)
Similarity:31/61 - (50%) Gaps:9/61 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CLQPLDVG------PCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACIPKK 129
            |.|..|.|      |..:   :||::..:..|:...|.||.||:||:..|..|.:||:|.|
 Worm    21 CRQEKDTGVNCDNKPITL---KFYFDMRTNVCQPLFYRGCGGNENRFESRDACSDACVPHK 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 17/55 (31%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421 18/56 (32%)
KU 158..213 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.