DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and E01G6.1

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_510044.2 Gene:E01G6.1 / 181387 WormBaseID:WBGene00008449 Length:1467 Species:Caenorhabditis elegans


Alignment Length:109 Identity:29/109 - (26%)
Similarity:45/109 - (41%) Gaps:26/109 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LTQAVATPNNNNNNNNNIKPKAVVQVQPGNPSGNKPAVATTTIKPQRLVPDPKCLQPLDVG-PC- 84
            |.||...||.:           ..|:....||   |....|        |:..|.:.:..| || 
 Worm   407 LAQADTCPNQH-----------FCQLPLFGPS---PICCPT--------PELTCNEMVSAGTPCF 449

  Fly    85 --RMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACI 126
              .::::|||:|..::.|:.|.|.||.||.|.:.....|:..|:
 Worm   450 GRGLTIQRFYFNPSTQKCQPFHYYGCSGNGNNFETVDQCQNFCL 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 17/53 (32%)
E01G6.1NP_510044.2 WR1 289..325 CDD:214601
Kunitz_BPTI 330..386 CDD:425421
Kunitz_BPTI 437..492 CDD:425421 17/54 (31%)
Kunitz_BPTI 541..596 CDD:425421
Lustrin_cystein 604..648 CDD:464222
Lustrin_cystein 859..902 CDD:464222
Lustrin_cystein 909..951 CDD:464222
Lustrin_cystein 1197..1239 CDD:464222
EB 1265..1321 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.