DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and C02F12.5

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_508632.2 Gene:C02F12.5 / 180656 WormBaseID:WBGene00015355 Length:176 Species:Caenorhabditis elegans


Alignment Length:38 Identity:12/38 - (31%)
Similarity:19/38 - (50%) Gaps:0/38 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACIP 127
            ::||:.....|..:||.||....|.:...:.|.|:|.|
 Worm    39 KWYYDSKLLFCYPYKYLGCGEGSNSFESNENCLESCKP 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 10/34 (29%)
C02F12.5NP_508632.2 KU <34..74 CDD:197529 10/34 (29%)

Return to query results.
Submit another query.