DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Y57A10A.24

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001370094.1 Gene:Y57A10A.24 / 174864 WormBaseID:WBGene00013264 Length:520 Species:Caenorhabditis elegans


Alignment Length:67 Identity:16/67 - (23%)
Similarity:26/67 - (38%) Gaps:13/67 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NNIKPKAVVQVQPGNPSGNKPAVATTTIKP---QRLVPDPKCLQPLDVGPCRMSLERFYYNKDSK 98
            |.|.|..:..:.|.  :....:..|||.||   :.::..|.|  |....|.:      ..|:|.:
 Worm   431 NRILPPQIPMIGPF--TFMTSSTTTTTEKPIEEEEVIAQPTC--PFSYMPSK------NVNQDVQ 485

  Fly    99 AC 100
            .|
 Worm   486 RC 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 6/26 (23%)
Y57A10A.24NP_001370094.1 Lustrin_cystein 470..513 CDD:464222 6/26 (23%)

Return to query results.
Submit another query.