DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and K10D3.4

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_492020.1 Gene:K10D3.4 / 172452 WormBaseID:WBGene00010738 Length:922 Species:Caenorhabditis elegans


Alignment Length:60 Identity:27/60 - (45%)
Similarity:38/60 - (63%) Gaps:7/60 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 CLQPLDVG-PCRMS-LERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCE-----EACIP 127
            |.||.||| .|..: :.|:|:|.|||.|:||:|.||.||.|.:..:::|:     |||.|
 Worm   629 CSQPRDVGVRCSSTRISRWYFNADSKTCQTFEYNGCEGNRNNFASQKSCQNYCLSEACPP 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 24/56 (43%)
K10D3.4NP_492020.1 EB 46..100 CDD:460294
Kunitz_BPTI 170..226 CDD:425421
KU <312..352 CDD:197529
Kunitz_BPTI 410..462 CDD:425421
Kunitz_BPTI 518..571 CDD:425421
Kunitz_BPTI 628..681 CDD:425421 23/51 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.