DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and CG43703

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster


Alignment Length:58 Identity:16/58 - (27%)
Similarity:27/58 - (46%) Gaps:6/58 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 DPKC-LQPLDVGPC---RMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            ||.| |:| .|..|   :.||..:.|::....|...| ..|:....|:..::.|::.|
  Fly    22 DPICGLKP-RVNRCISAKESLVLYGYSESRNICYKIK-NPCQTLVRRFATKEICQKLC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 13/53 (25%)
CG43703NP_001260009.1 None

Return to query results.
Submit another query.