DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and WFDC6

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_543017.1 Gene:WFDC6 / 140870 HGNCID:16164 Length:86 Species:Homo sapiens


Alignment Length:60 Identity:15/60 - (25%)
Similarity:28/60 - (46%) Gaps:10/60 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 QPGNPSG--NKPAVATTTIKPQRLVPD-PKCLQPLDVGPCRMSLERFYYNKDSKACETFK 104
            :||:..|  .||.   ..||.:..|.: .:|.:|.|   |..:::...::: .|.|..|:
Human    21 EPGHAEGILGKPC---PKIKVECEVEEIDQCTKPRD---CPENMKCCPFSR-GKKCLDFR 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 7/30 (23%)
WFDC6NP_543017.1 WAP <33..71 CDD:469631 9/44 (20%)

Return to query results.
Submit another query.