DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and Ambp

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_031469.1 Gene:Ambp / 11699 MGIID:88002 Length:349 Species:Mus musculus


Alignment Length:96 Identity:32/96 - (33%)
Similarity:47/96 - (48%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NNNIKPKAVVQV------QPGNPSGNKPAVATTTIKPQRLVPDPKCLQPLDVGPCRMSLERFYYN 94
            :..::|.::.:.      |....||.:|.: |.|:|     .:..|......|||....||:|||
Mouse   191 DREVEPTSIARARRAVLPQESEGSGTEPLI-TGTLK-----KEDSCQLNYSEGPCLGMQERYYYN 249

  Fly    95 KDSKACETFKYGGCRGNDNRWGFRQTCEEAC 125
            ..|.|||||:||||.||.|.:...:.|.:.|
Mouse   250 GASMACETFQYGGCLGNGNNFISEKDCLQTC 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 23/49 (47%)
AmbpNP_031469.1 lipocalin_A1M-like 27..189 CDD:381193
Kunitz_bikunin_1-like 228..281 CDD:438639 24/53 (45%)
Kunitz_bikunin_2-like 284..337 CDD:438640
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.