DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and SPINT3

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_006643.1 Gene:SPINT3 / 10816 HGNCID:11248 Length:89 Species:Homo sapiens


Alignment Length:67 Identity:26/67 - (38%)
Similarity:42/67 - (62%) Gaps:3/67 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VATTTIKPQRLVPDPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEE 123
            :|..|||.  |:|: .|..|::.|||:..:.|:::|.::..||.|.||||.||.|.:..::.||:
Human    23 LARDTIKD--LLPN-VCAFPMEKGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEK 84

  Fly   124 AC 125
            .|
Human    85 FC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 19/49 (39%)
SPINT3NP_006643.1 Kunitz_BPTI 35..87 CDD:425421 20/52 (38%)

Return to query results.
Submit another query.