DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10031 and col28a1b

DIOPT Version :10

Sequence 1:NP_608802.2 Gene:CG10031 / 33594 FlyBaseID:FBgn0031563 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001289178.1 Gene:col28a1b / 100332225 ZFINID:ZDB-GENE-160503-1 Length:1109 Species:Danio rerio


Alignment Length:69 Identity:27/69 - (39%)
Similarity:41/69 - (59%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TTIKP----QRLVPDPKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCE 122
            ||..|    |....|.:||||||.||||..:.::|::..:.:|..|.:|||:||.|::....||.
Zfish  1039 TTDPPLIFQQDFTADERCLQPLDPGPCREYVVKWYFDPKANSCAQFWFGGCKGNKNQFDSELTCR 1103

  Fly   123 EACI 126
            :.|:
Zfish  1104 KTCV 1107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10031NP_608802.2 Kunitz-type 75..125 CDD:438633 21/49 (43%)
col28a1bNP_001289178.1 VWA 45..226 CDD:459670
gly_rich_SclB <243..>313 CDD:468478
gly_rich_SclB <291..>568 CDD:468478
gly_rich_SclB <491..>773 CDD:468478
vWFA 797..987 CDD:469594
Kunitz_collagen_alpha1_XXVIII 1056..1106 CDD:438671 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.