DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and CG42538

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001163451.1 Gene:CG42538 / 8673985 FlyBaseID:FBgn0260646 Length:89 Species:Drosophila melanogaster


Alignment Length:49 Identity:15/49 - (30%)
Similarity:21/49 - (42%) Gaps:7/49 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQ 103
            |....:.|..|       ||..::.||:..|.||.||.|.:...|.|.:
  Fly    45 CGLTAQNGMWF-------YNSRSRRCEKMNYRGCGGNGNRYCKVEDCNR 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 15/49 (31%)
CG42538NP_001163451.1 Kunitz-type <53..86 CDD:438633 13/39 (33%)

Return to query results.
Submit another query.