DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and aplp2

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_005159308.1 Gene:aplp2 / 796801 ZFINID:ZDB-GENE-061009-28 Length:776 Species:Danio rerio


Alignment Length:101 Identity:38/101 - (37%)
Similarity:52/101 - (51%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNK 92
            ||..|||..|  .|...|.:...|...|....|||.|.|...|:.:::..:.|..|:|||||||:
Zfish   290 DVKKEKAVMP--EKQDDDKTLQEVEAVCSLEAETGPCRASMPRWHFDMQQRKCVRFIYGGCAGNR 352

  Fly    93 NNFESKEQCEQACLVKSAVSSTDSTTEQNSEVATET 128
            |||:|:|.|...| .:..|..|...|: :.:|..||
Zfish   353 NNFDSEEYCMVVC-KRLTVPPTPQPTD-DVDVYFET 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 22/52 (42%)
aplp2XP_005159308.1 A4_EXTRA 31..195 CDD:128326
APP_N 38..138 CDD:280358
APP_Cu_bd 140..195 CDD:289676
Kunitz_BPTI 314..366 CDD:278443 23/52 (44%)
APP_E2 371..553 CDD:289677 5/17 (29%)
APP_amyloid 722..772 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.