Protein Alignment CG3604 and Eppin

DIOPT Version :9

• Sequence 1: NP_001285595.1
• Gene: CG3604 / 33593
• FlyBaseID: FBgn0031562
• Length: 132
• Species: Drosophila melanogaster
• Sequence 2: NP_083601.1
• Gene: Eppin / 75526
• MGIID: 1922776
• Length: 134
• Species: Mus musculus
• Alignment Length: 58
• Identity: 26/58 - (44%)
• Similarity: 40/58 - (68%)
• Gaps: 0/58 - (0%)

  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVS 112
            |..||::|.|.|.|.|:.:|.:..:|:.|:||||.||.|||:|:..|:.||..||:::
Mouse    77 CSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNACEKKSSLT 134

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
CG3604	NP_001285595.1	KU	53..106	CDD:238057	23/50 (46%)
Eppin	NP_083601.1	WAP	32..72	CDD:278522
		Kunitz_BPTI	76..127	CDD:278443	22/49 (45%)
		Interaction with SEMG1. /evidence=ECO:0000250	102..133		17/30 (57%)
		Interaction with LTF. /evidence=ECO:0000250	117..133		7/15 (47%)

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	66	1.000	Domainoid score	I9900
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X627
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	6	5.810