powered by:
Protein Alignment CG3604 and Eppin
DIOPT Version :9
Sequence 1: | NP_001285595.1 |
Gene: | CG3604 / 33593 |
FlyBaseID: | FBgn0031562 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102927.1 |
Gene: | Eppin / 685161 |
RGDID: | 1597722 |
Length: | 134 |
Species: | Rattus norvegicus |
Alignment Length: | 55 |
Identity: | 27/55 - (49%) |
Similarity: | 36/55 - (65%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKS 109
|..||::|.|.|.|.|:.||....:|:.|:||||.||.|||:|:..|:.||..||
Rat 77 CSLPKDSGYCMAYFPRWWYNKKNGTCQLFIYGGCQGNNNNFQSQSICQNACEKKS 131
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
65 |
1.000 |
Domainoid score |
I9775 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X627 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.810 |
|
Return to query results.
Submit another query.