DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Wfdc6a

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001233212.2 Gene:Wfdc6a / 685153 RGDID:1597730 Length:146 Species:Rattus norvegicus


Alignment Length:93 Identity:33/93 - (35%)
Similarity:44/93 - (47%) Gaps:11/93 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VEKAEEPAVAKPLPDASE----------LTVPED-CHQPKETGRCFALFYRYAYNVDTQSCEEFV 84
            ||:..|....:..||...          :.:.|| |..|::.|.|.|...|:.||.||..|.:|:
  Rat    52 VEERNECTRHRQCPDKKRCCFFSCGKKCMDLREDICSLPQDAGPCLAYLPRWWYNEDTGLCTQFI 116

  Fly    85 YGGCAGNKNNFESKEQCEQACLVKSAVS 112
            ||||.||.|||:|:..|...|..|...|
  Rat   117 YGGCQGNPNNFQSEGICTVVCKKKQMSS 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 25/53 (47%)
Wfdc6aNP_001233212.2 WAP 42..81 CDD:278522 5/28 (18%)
Kunitz_BPTI 86..138 CDD:278443 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I9775
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X627
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.