DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Spint3

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_006235690.1 Gene:Spint3 / 685136 RGDID:1597746 Length:87 Species:Rattus norvegicus


Alignment Length:105 Identity:37/105 - (35%)
Similarity:50/105 - (47%) Gaps:21/105 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCFRYSFSFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCF 65
            |..:.||||.     |:|.         ...|...||..|:.       ::|..|..|.|.|.|.
  Rat     1 MQLQASFSFF-----LILT---------FCQELCSEPRQARK-------SLPSMCTLPMEKGECR 44

  Fly    66 ALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |:|.|:.|:..|:.|:.|.||||.||:|||.|:.||:..|
  Rat    45 AIFVRWYYDTKTKKCDWFHYGGCRGNENNFLSRNQCQTVC 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 25/53 (47%)
Spint3XP_006235690.1 KU 34..84 CDD:238057 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564520at2759
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 1 1.000 - - oto97438
orthoMCL 1 0.900 - - OOG6_127556
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.