DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and SPINT1

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens


Alignment Length:81 Identity:29/81 - (35%)
Similarity:39/81 - (48%) Gaps:19/81 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PDASE----------------LTVPED---CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCA 89
            ||||:                :..|.|   |....:||.|.....|:.||..::.|..|.||||.
Human   361 PDASDEAACEKYTSGFDELQRIHFPSDKGHCVDLPDTGLCKESIPRWYYNPFSEHCARFTYGGCY 425

  Fly    90 GNKNNFESKEQCEQAC 105
            |||||||.::||.::|
Human   426 GNKNNFEEEQQCLESC 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 22/49 (45%)
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566 4/4 (100%)
Kunitz_HAI1_2-like 390..450 CDD:438667 23/52 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.