DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Spint3

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001170872.1 Gene:Spint3 / 629747 MGIID:3651470 Length:88 Species:Mus musculus


Alignment Length:101 Identity:37/101 - (36%)
Similarity:50/101 - (49%) Gaps:21/101 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YSFSFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFY 69
            |.|.|:    :|:....:.|.|::|              |..|   :|..|..||:.|.|.|:|.
Mouse     6 YFFLFL----ILIFCQELCAEPNNV--------------PRKS---LPPMCILPKDIGGCRAVFV 49

  Fly    70 RYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |:.||..|..||.|.||||.||:|||.|:.||:..|
Mouse    50 RWYYNSKTGKCEWFRYGGCKGNENNFPSRSQCQAVC 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 27/53 (51%)
Spint3NP_001170872.1 Kunitz_BPTI 35..85 CDD:278443 26/49 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9900
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_127556
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5595
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.