DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and appa

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_571639.1 Gene:appa / 58083 ZFINID:ZDB-GENE-000616-13 Length:738 Species:Danio rerio


Alignment Length:103 Identity:35/103 - (33%)
Similarity:49/103 - (47%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DVVVEKAEE------------PAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSC 80
            |..:|:.||            .:......::.|..|.|.|....|||.|.|:..|:.|..:.:.|
Zfish   254 DEKIEEEEEEEERTQSTSAALTSTTTTTTESVEEVVREVCFASAETGPCRAMLSRWYYVREERRC 318

  Fly    81 EEFVYGGCAGNKNNFESKEQCEQACLVKSAVSSTDSTT 118
            ..|:||||.||:|||||:|.|...|   |.|..|.|::
Zfish   319 APFIYGGCGGNRNNFESEEYCLSVC---SGVLPTPSSS 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 24/52 (46%)
appaNP_571639.1 A4_EXTRA 28..189 CDD:128326
APP_N 32..132 CDD:280358
APP_Cu_bd 134..189 CDD:289676
Kunitz_BPTI 293..343 CDD:278443 23/49 (47%)
APP_E2 349..531 CDD:289677 2/5 (40%)
Beta-APP 643..681 CDD:281491
APP_amyloid 684..734 CDD:287486
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.