DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and spint2

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:89 Identity:34/89 - (38%)
Similarity:49/89 - (55%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESK 98
            ||.....|...:...|...:.|..|...|.|.|.|.|:.|::..|:|:.|:||||.||:|||.|:
Zfish   112 AETTKGQKNQAEVRTLNTTDHCRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQ 176

  Fly    99 EQCEQACL-VKSAVSSTDSTTEQN 121
            .:||.:|| ||.||....|.:.::
Zfish   177 AECEASCLGVKGAVEDARSVSPRS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 23/49 (47%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633 23/49 (47%)
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.