DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and spint2

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:89 Identity:34/89 - (38%)
Similarity:49/89 - (55%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 AEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESK 98
            ||.....|...:...|...:.|..|...|.|.|.|.|:.|::..|:|:.|:||||.||:|||.|:
Zfish   112 AETTKGQKNQAEVRTLNTTDHCRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQ 176

  Fly    99 EQCEQACL-VKSAVSSTDSTTEQN 121
            .:||.:|| ||.||....|.:.::
Zfish   177 AECEASCLGVKGAVEDARSVSPRS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 23/52 (44%)
spint2NP_001070718.2 MANEC 23..100 CDD:297649
Kunitz_BPTI 133..183 CDD:278443 23/49 (47%)
Kunitz_BPTI 228..276 CDD:278443
Kunitz_BPTI 304..354 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10037
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.