DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and tfpi2

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001035185.1 Gene:tfpi2 / 560339 ZFINID:ZDB-GENE-060503-38 Length:233 Species:Danio rerio


Alignment Length:133 Identity:35/133 - (26%)
Similarity:55/133 - (41%) Gaps:35/133 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPL---------PDASELT------------- 50
            :.::|.:||..|.|:...|.:|.:.:.||......:         ....|.:             
Zfish     8 ALLLFISVLESAVGLTLQPKEVCLLQIEEGTCNDDIQRFYYNTISQQCEEFSYSGCGGNQNNFRS 72

  Fly    51 -------------VPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCE 102
                         :|:.|...|:.|.|..||.||.:|:.:..||.|.||||.||:|||.:.|:|.
Zfish    73 FVECQKTCFRIPKIPQICRFQKKEGPCRGLFSRYFFNMTSMQCEPFTYGGCQGNENNFRNPEECI 137

  Fly   103 QAC 105
            :.|
Zfish   138 EYC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 24/53 (45%)
tfpi2NP_001035185.1 KU 28..80 CDD:197529 4/51 (8%)
Kunitz_BPTI 89..141 CDD:278443 24/52 (46%)
Kunitz_BPTI 149..201 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.