powered by:
Protein Alignment CG3604 and tfpi2
DIOPT Version :9
Sequence 1: | NP_001285595.1 |
Gene: | CG3604 / 33593 |
FlyBaseID: | FBgn0031562 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001015766.1 |
Gene: | tfpi2 / 548483 |
XenbaseID: | XB-GENE-1002090 |
Length: | 219 |
Species: | Xenopus tropicalis |
Alignment Length: | 74 |
Identity: | 31/74 - (41%) |
Similarity: | 41/74 - (55%) |
Gaps: | 5/74 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 EKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFE 96
:||.......|..|| |..|:.||:.|.|.|...||.:|:::::||||||.||.||.|||.
Frog 131 DKASCMDFCSPRRDA-----PSFCYSPKDEGSCSASVTRYYFNIESKACEEFVYTGCGGNSNNFV 190
Fly 97 SKEQCEQAC 105
..|.|:..|
Frog 191 KMEDCDSVC 199
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
67 |
1.000 |
Domainoid score |
I9689 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR10083 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.010 |
|
Return to query results.
Submit another query.