DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and tfpi2

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001015766.1 Gene:tfpi2 / 548483 XenbaseID:XB-GENE-1002090 Length:219 Species:Xenopus tropicalis


Alignment Length:74 Identity:31/74 - (41%)
Similarity:41/74 - (55%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFE 96
            :||.......|..||     |..|:.||:.|.|.|...||.:|:::::||||||.||.||.|||.
 Frog   131 DKASCMDFCSPRRDA-----PSFCYSPKDEGSCSASVTRYYFNIESKACEEFVYTGCGGNSNNFV 190

  Fly    97 SKEQCEQAC 105
            ..|.|:..|
 Frog   191 KMEDCDSVC 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 25/53 (47%)
tfpi2NP_001015766.1 Kunitz_BPTI 28..79 CDD:278443
Kunitz_BPTI 88..139 CDD:278443 2/7 (29%)
Kunitz_BPTI 148..200 CDD:278443 25/52 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9689
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.