DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Wfdc6b

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:66 Identity:33/66 - (50%)
Similarity:41/66 - (62%) Gaps:1/66 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LTVPED-CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVS 112
            |.:.|| |..|::.|.|.|...|:.||.||:.|.||:||||.||.||||||..|...|:.|..:|
Mouse    88 LDLSEDICSLPQDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSICINKRKMS 152

  Fly   113 S 113
            |
Mouse   153 S 153

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 28/53 (53%)