DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Spint5p

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001008881.1 Gene:Spint5p / 408232 RGDID:1302989 Length:167 Species:Rattus norvegicus


Alignment Length:70 Identity:31/70 - (44%)
Similarity:41/70 - (58%) Gaps:4/70 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQC 101
            |.|...|.::..|    .|:||.:.|.|...||||.:|.||..||.|::.||.||:|||:||..|
  Rat    54 PGVRNQLCESGHL----GCNQPVKKGHCTFRFYRYYFNKDTALCELFIFSGCGGNRNNFKSKYLC 114

  Fly   102 EQACL 106
            |..|:
  Rat   115 ELHCI 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 26/52 (50%)
Spint5pNP_001008881.1 KU 68..118 CDD:197529 26/49 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10083
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.