DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and spint1a

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_021322811.1 Gene:spint1a / 406426 ZFINID:ZDB-GENE-040426-2169 Length:523 Species:Danio rerio


Alignment Length:62 Identity:27/62 - (43%)
Similarity:38/62 - (61%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSAVSSTDS 116
            |..||:.|.|...|.|:.||..|:.||||.:|||..|:||:.:..:|:.|| .|.:||:..|
Zfish   247 CLVPKKEGPCRGSFPRWHYNAATEKCEEFKFGGCVPNRNNYLALNECQSAC-NKVSVSNIGS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 22/50 (44%)
spint1aXP_021322811.1 MANEC 33..120 CDD:311445
PKD 157..237 CDD:214510
Kunitz_BPTI 247..297 CDD:278443 21/49 (43%)
LDLa 329..363 CDD:238060
Kunitz_BPTI 384..435 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.