DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and ambp

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_957412.2 Gene:ambp / 394093 ZFINID:ZDB-GENE-040426-1608 Length:346 Species:Danio rerio


Alignment Length:89 Identity:32/89 - (35%)
Similarity:49/89 - (55%) Gaps:4/89 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYG 86
            |:.|..:|||..|||.:.    .|......|:.|....::|.||.:..|:.||....||:.|.:|
Zfish   196 IQRARRNVVVPPAEEGSG----DDMPMFRGPDACKSEPDSGPCFGMLTRFHYNSSIMSCQMFTFG 256

  Fly    87 GCAGNKNNFESKEQCEQACLVKSA 110
            ||.||:|||.:::.|.|:|..::|
Zfish   257 GCMGNQNNFPTEKDCLQSCRTEAA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 20/52 (38%)
ambpNP_957412.2 Lipocalin 37..182 CDD:278490
Kunitz_BPTI 224..276 CDD:278443 20/51 (39%)
Kunitz_BPTI 280..332 CDD:278443 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.