DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3604 and tfpia

DIOPT Version :9

Sequence 1:	NP_001285595.1	Gene:	CG3604 / 33593	FlyBaseID:	FBgn0031562	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_001296732.1	Gene:	tfpia / 359833	ZFINID:	ZDB-GENE-030711-1	Length:	279	Species:	Danio rerio

Alignment Length:	62	Identity:	29/62 - (46%)
Similarity:	40/62 - (64%)	Gaps:	1/62 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 SELTV-PEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLV 107
            |||.: .:.|...|:.|.|.|:..|:.:::||..||.|.||||.||.||||:.:.||:.|||
Zfish    33 SELRIFHQSCALKKDEGPCKAMKDRFYFDIDTGRCEPFEYGGCQGNANNFETLQDCEEMCLV 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3604	NP_001285595.1	KU	53..106	CDD:238057	23/52 (44%)
tfpia	NP_001296732.1	Kunitz_BPTI	42..92	CDD:278443	23/49 (47%)
		KU	99..151	CDD:238057
		Kunitz_BPTI	205..256	CDD:278443
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR10083
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	5	4.910