DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and COL28A1

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001032852.2 Gene:COL28A1 / 340267 HGNCID:22442 Length:1125 Species:Homo sapiens


Alignment Length:91 Identity:28/91 - (30%)
Similarity:43/91 - (47%) Gaps:16/91 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EKAEEPAVAKPLP--DASE--------LTVPED------CHQPKETGRCFALFYRYAYNVDTQSC 80
            :||.||..|..||  .:||        |:.|.|      |.:..:.|.|.....|:.|:....||
Human  1033 DKAPEPTWADDLPATTSSEATTTPRPLLSTPVDGAEDPRCLEALKPGNCGEYVVRWYYDKQVNSC 1097

  Fly    81 EEFVYGGCAGNKNNFESKEQCEQACL 106
            ..|.:.||.|:.|.|.|:::|::.|:
Human  1098 ARFWFSGCNGSGNRFNSEKECQETCI 1123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 15/49 (31%)
COL28A1NP_001032852.2 vWFA_subfamily_ECM 47..209 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..769
gly_rich_SclB <272..>582 CDD:468478
gly_rich_SclB <478..>759 CDD:468478
VWA 798..974 CDD:459670
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 999..1066 11/32 (34%)
Kunitz-type 1072..1122 CDD:444694 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.