DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and CG2816

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:51 Identity:26/51 - (50%)
Similarity:31/51 - (60%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |.||..:||||.....||||...:.||.|:||||.||.|.|.:|.:||..|
  Fly    31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 26/51 (51%)
CG2816NP_608803.2 Kunitz_BPTI 31..82 CDD:278443 26/51 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6867
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564520at2759
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X627
65.770

Return to query results.
Submit another query.