powered by:
Protein Alignment CG3604 and CG2816
DIOPT Version :9
Sequence 1: | NP_001285595.1 |
Gene: | CG3604 / 33593 |
FlyBaseID: | FBgn0031562 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608803.2 |
Gene: | CG2816 / 33595 |
FlyBaseID: | FBgn0031564 |
Length: | 84 |
Species: | Drosophila melanogaster |
Alignment Length: | 51 |
Identity: | 26/51 - (50%) |
Similarity: | 31/51 - (60%) |
Gaps: | 0/51 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
|.||..:||||.....||||...:.||.|:||||.||.|.|.:|.:||..|
Fly 31 CLQPMISGRCFGYVESYAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNC 81
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S6867 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1564520at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X627 |
|
6 | 5.770 |
|
Return to query results.
Submit another query.