powered by:
Protein Alignment CG3604 and IM33
DIOPT Version :9
Sequence 1: | NP_001285595.1 |
Gene: | CG3604 / 33593 |
FlyBaseID: | FBgn0031562 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001285594.1 |
Gene: | IM33 / 33592 |
FlyBaseID: | FBgn0031561 |
Length: | 82 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 21/43 - (48%) |
Similarity: | 31/43 - (72%) |
Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 RCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
:|.|....::|:.:|.|||:|:||||.||:|.|.::|.|||.|
Fly 38 KCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3604 | NP_001285595.1 |
KU |
53..106 |
CDD:238057 |
21/43 (49%) |
IM33 | NP_001285594.1 |
KU |
23..81 |
CDD:238057 |
21/43 (49%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10083 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.910 |
|
Return to query results.
Submit another query.