DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and CG16713

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:53 Identity:23/53 - (43%)
Similarity:29/53 - (54%) Gaps:2/53 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 HQPKETGR--CFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACL 106
            |.....||  |.|....::|:.|...|.:|:||||.||.|.|.|:|.||..||
  Fly    29 HSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 21/50 (42%)
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/50 (42%)

Return to query results.
Submit another query.