powered by:
Protein Alignment CG3604 and CG3513
DIOPT Version :9
Sequence 1: | NP_001285595.1 |
Gene: | CG3604 / 33593 |
FlyBaseID: | FBgn0031562 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_608798.1 |
Gene: | CG3513 / 33590 |
FlyBaseID: | FBgn0031559 |
Length: | 88 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 23/61 - (37%) |
Similarity: | 33/61 - (54%) |
Gaps: | 7/61 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 PEDCHQP-------KETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
||.|.|| ::...|.|....:.|:....:|.||::|||.||.|.|.:|.:||:||
Fly 26 PEMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3604 | NP_001285595.1 |
KU |
53..106 |
CDD:238057 |
22/60 (37%) |
CG3513 | NP_608798.1 |
KU |
29..87 |
CDD:238057 |
21/58 (36%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.