DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and CG16704

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_608797.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster


Alignment Length:98 Identity:28/98 - (28%)
Similarity:37/98 - (37%) Gaps:23/98 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYN 74
            :|||.:..|.|...|...:.:.  .||..|                     .|.|.:|...:.|.
  Fly     5 VVFALICCLVASAFATLKNPIC--GEEFGV---------------------KGTCRSLQPMWTYR 46

  Fly    75 VDTQSCEEFVYGGCAGNKNNFESKEQCEQACLV 107
            .||..|..|.|.||.||.|.|..|.:||:.|.:
  Fly    47 PDTNECFTFNYSGCHGNNNLFHKKLECEEKCKI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 18/49 (37%)
CG16704NP_608797.1 Kunitz-type 32..77 CDD:444694 19/65 (29%)

Return to query results.
Submit another query.