DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3604 and APLP2

DIOPT Version :9

Sequence 1:	NP_001285595.1	Gene:	CG3604 / 33593	FlyBaseID:	FBgn0031562	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_001633.1	Gene:	APLP2 / 334	HGNCID:	598	Length:	763	Species:	Homo sapiens

Alignment Length:	100	Identity:	36/100 - (36%)
Similarity:	51/100 - (51%)	Gaps:	6/100 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    32 EKAEEPAVAKPLPDASELT--VPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNN 94
            |...||.....:.| .|:|  |...|.|...||.|.|:..|:.:::....|..|:||||.||:||
Human   286 ENPTEPGSDGTMSD-KEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNN 349

  Fly    95 FESKEQCEQACLVKSAVSSTDSTTEQNSEVATETS 129
            |||::.|...|  |:.:..|...| .:.:|..|||
Human   350 FESEDYCMAVC--KAMIPPTPLPT-NDVDVYFETS 381

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3604	NP_001285595.1	KU	53..106	CDD:238057	21/52 (40%)
APLP2	NP_001633.1	A4_EXTRA	42..204	CDD:128326
		GFLD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	46..139
		APP_N	49..147	CDD:280358
		CuBD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	147..205
		APP_Cu_bd	149..204	CDD:289676
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	211..299		3/12 (25%)
		Kunitz_BPTI	309..361	CDD:278443	22/53 (42%)
		APP_E2	365..547	CDD:289677	5/17 (29%)
		APP_amyloid	709..759	CDD:287486
		Interaction with DAB2. /evidence=ECO:0000250	749..763
		NPXY motif	750..755
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810