DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and CG31515

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster


Alignment Length:118 Identity:35/118 - (29%)
Similarity:45/118 - (38%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCFRYSFSFIVFAAVLLLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCF 65
            :.:.:.||..||..|.:..:.||.      :.|.....|.:           |.|......|||.
  Fly    10 LLWAFFFSTEVFGKVKIRESDIRR------ITKMGSYKVRQ-----------EKCLFIPSYGRCK 57

  Fly    66 ALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLV---KSAVSSTD 115
            .....|.||:.|..|.||.|.||.||.|.|.:..||...|.|   :..||..|
  Fly    58 KHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRNTCYVVPARKTVSEPD 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 21/52 (40%)
CG31515NP_732865.2 KU 47..97 CDD:197529 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X627
44.010

Return to query results.
Submit another query.