DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and wu:fb59d01

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001373281.1 Gene:wu:fb59d01 / 322379 ZFINID:ZDB-GENE-030131-1098 Length:211 Species:Danio rerio


Alignment Length:83 Identity:34/83 - (40%)
Similarity:45/83 - (54%) Gaps:4/83 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGN 91
            ||....||..|...:..| ..|.::   |....:.|.|||||..|.||.:.:.|..|:|.||.||
Zfish    69 SDKECVKACSPKALQIYP-TDETSI---CSMEMDEGTCFALFPMYYYNAEEKICRMFIYRGCRGN 129

  Fly    92 KNNFESKEQCEQACLVKS 109
            .|.|||:|:|:|.||.:|
Zfish   130 ANRFESREECQQTCLARS 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 24/52 (46%)
wu:fb59d01NP_001373281.1 Kunitz_BPTI 27..77 CDD:394972 3/7 (43%)
Kunitz_BPTI 92..143 CDD:394972 24/53 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I10037
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X627
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.