DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Col28a1

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001418648.1 Gene:Col28a1 / 312115 RGDID:1564680 Length:1141 Species:Rattus norvegicus


Alignment Length:103 Identity:27/103 - (26%)
Similarity:48/103 - (46%) Gaps:12/103 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LLLAAGIRAAPSDVVVEKAEEPAVAKP------LPD----ASELTVPED--CHQPKETGRCFALF 68
            :|..||..|.|:........:|.::.|      .|:    .||.::.:|  |.:..:.|.|....
  Rat  1037 VLTEAGNLAIPTPPEATNTLKPLLSSPERVEARTPNPNLLQSEKSLYKDPRCEEALKPGNCGDYV 1101

  Fly    69 YRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACL 106
            .|:.|:....||..|.:.||.|:.|.|.|:::|::.|:
  Rat  1102 VRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECQETCI 1139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 15/49 (31%)
Col28a1NP_001418648.1 vWFA_subfamily_ECM 47..212 CDD:238727
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
Collagen 713..772 CDD:460189
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 15/49 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.