DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3604 and Spint1

DIOPT Version :9

Sequence 1:	NP_001285595.1	Gene:	CG3604 / 33593	FlyBaseID:	FBgn0031562	Length:	132	Species:	Drosophila melanogaster
Sequence 2:	NP_001004265.2	Gene:	Spint1 / 311331	RGDID:	1303138	Length:	507	Species:	Rattus norvegicus

Alignment Length:	51	Identity:	23/51 - (45%)
Similarity:	32/51 - (62%)	Gaps:	0/51 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly    55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |.:..:||.|.....|:.||..::.|..|.||||.|||||||.::||.::|
  Rat   369 CAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEKEQQCLESC 419

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3604	NP_001285595.1	KU	53..106	CDD:238057	23/51 (45%)
Spint1	NP_001004265.2	MANEC	44..133	CDD:284837
		Kunitz_BPTI	243..295	CDD:278443
		LDLa	313..344	CDD:197566
		Kunitz_BPTI	368..420	CDD:278443	23/51 (45%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	1	1.000	-	-
TreeFam	0	0.000	Not matched by this tool.
	3	2.810