DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Spint2

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001076018.1 Gene:Spint2 / 292770 RGDID:735123 Length:250 Species:Rattus norvegicus


Alignment Length:116 Identity:39/116 - (33%)
Similarity:54/116 - (46%) Gaps:28/116 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCE 81
            ||.:|.:||..|                    |.|.|.|...|..|:|.|...|:.|||...:|:
  Rat    20 LLLSGAQAASRD--------------------LDVHESCGVSKVVGKCRASIPRWWYNVTDGTCQ 64

  Fly    82 EFVYGGCAGNKNNFESKEQCEQACLVKSAVSSTDSTTE---QNSEVATETS 129
            .||||||.||.||:.|||:|...|     ...|::|.:   ::|:.|:..|
  Rat    65 PFVYGGCEGNGNNYPSKEECLDKC-----AGITENTIDGLARSSDGASALS 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 24/49 (49%)
Spint2NP_001076018.1 Kunitz_HAI2_1-like 36..88 CDD:438664 25/51 (49%)
Kunitz_HAI2_2-like 129..181 CDD:438665
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.