DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and AMBP

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:95 Identity:34/95 - (35%)
Similarity:49/95 - (51%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLAAGIRAAPSDVVVEKAEEPAVAKPLPDASELTVPED-CHQPKETGRCFALFYRYAYNVDTQSC 80
            :|...:|.|    |:.:.||.:....|  .:|:|..|| |......|.|..:..||.||..:.:|
Human   198 ILIPRVRRA----VLPQEEEGSGGGQL--VTEVTKKEDSCQLGYSAGPCMGMTSRYFYNGTSMAC 256

  Fly    81 EEFVYGGCAGNKNNFESKEQCEQACLVKSA 110
            |.|.||||.||.|||.::::|.|.|...:|
Human   257 ETFQYGGCMGNGNNFVTEKECLQTCRTVAA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 21/49 (43%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226 6/25 (24%)
Kunitz_bikunin_1-like 229..282 CDD:438639 22/52 (42%)
Kunitz_bikunin_2-like 284..338 CDD:438640 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.