DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Tfpi2

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001368837.1 Gene:Tfpi2 / 21789 MGIID:108543 Length:266 Species:Mus musculus


Alignment Length:53 Identity:25/53 - (47%)
Similarity:32/53 - (60%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 EDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105
            |.|..|.:.|.|.||..::.|:.|.|.|..|.||||.||.|||.|::.|:|.|
Mouse    70 EICLLPLDAGPCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTC 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 23/49 (47%)
Tfpi2NP_001368837.1 Kunitz_TFPI2_1-like 68..124 CDD:438659 25/53 (47%)
Kunitz-type 129..182 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 189..242 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.