DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Tfpi

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001342200.1 Gene:Tfpi / 21788 MGIID:1095418 Length:306 Species:Mus musculus


Alignment Length:86 Identity:34/86 - (39%)
Similarity:49/86 - (56%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSA 110
            ||....|:.|...::.|.|.....||.||..|:.||.||||||.||:||||:.::|::.|  ::.
Mouse   112 ASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC--ENP 174

  Fly   111 VSSTDSTTE-QNSEVATETST 130
            |.|.....| |.|:..|:.:|
Mouse   175 VHSPSPVNEVQMSDYVTDGNT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 23/52 (44%)
TfpiNP_001342200.1 KU 48..101 CDD:238057
Kunitz_BPTI 120..171 CDD:394972 23/50 (46%)
Kunitz_BPTI 224..276 CDD:394972
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10083
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.