DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and Tfpi

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_035706.1 Gene:Tfpi / 21788 MGIID:1095418 Length:306 Species:Mus musculus


Alignment Length:86 Identity:34/86 - (39%)
Similarity:49/86 - (56%) Gaps:3/86 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACLVKSA 110
            ||....|:.|...::.|.|.....||.||..|:.||.||||||.||:||||:.::|::.|  ::.
Mouse   112 ASGAERPDFCFLEEDPGLCRGYMKRYLYNNQTKQCERFVYGGCLGNRNNFETLDECKKIC--ENP 174

  Fly   111 VSSTDSTTE-QNSEVATETST 130
            |.|.....| |.|:..|:.:|
Mouse   175 VHSPSPVNEVQMSDYVTDGNT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 23/49 (47%)
TfpiNP_035706.1 Kunitz_TFPI1_1-like 47..101 CDD:438656
Kunitz_TFPI1_2-like 117..172 CDD:438657 25/56 (45%)
Kunitz_TFPI1_TFPI2_3-like 223..275 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.