DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and ZK287.4

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:65 Identity:21/65 - (32%)
Similarity:33/65 - (50%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQACL 106
            |:|..|     ..|.||..:|:......||.::.:.:.|..|:|.|..||:|||:|...|.:.|:
 Worm  1046 PMPPPS-----SQCSQPAASGQGDQYLSRYFFSPEYRQCLHFIYSGEGGNQNNFDSLTDCLETCV 1105

  Fly   107  106
             Worm  1106  1105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 17/49 (35%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:464222
Kunitz_BPTI 99..151 CDD:425421
Kunitz_conkunitzin 257..308 CDD:438636
KU 318..368 CDD:197529
Kunitz_conkunitzin 846..896 CDD:438636
Kunitz_conkunitzin 995..1043 CDD:438636
Kunitz_conkunitzin 1054..1104 CDD:438636 17/49 (35%)
Lustrin_cystein 1148..1189 CDD:464222
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.