DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and ZC504.1

DIOPT Version :9

Sequence 1:NP_001285595.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001362150.1 Gene:ZC504.1 / 191192 WormBaseID:WBGene00013916 Length:542 Species:Caenorhabditis elegans


Alignment Length:130 Identity:31/130 - (23%)
Similarity:53/130 - (40%) Gaps:40/130 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVEKAEEPAVAKPLPDASELT-----VPED----------CHQPKET----------GRCF---- 65
            :.||::: .|.|...|.::.:     ||..          |.|.:|:          |.||    
 Worm    34 IAEKSKD-GVIKWCEDTNDCSGGWKCVPSGQYHFSKQVNYCCQMRESICSMPPNPGYGDCFEEPR 97

  Fly    66 ALFYRYAYNVDTQSCEEFVYGGCAG-NKNNFESKEQCEQACLVKSAVSSTDSTTEQNSEVATETS 129
            .:||..:.::   .|::|....|.| |:|.||:.|.|.:.|      .||.....|:..:|.::|
 Worm    98 TMFYFDSLDL---KCKKFKVINCFGKNQNQFETYELCTRFC------QSTACLAGQSLLLARDSS 153

  Fly   130  129
             Worm   154  153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_001285595.1 KU 53..106 CDD:238057 18/77 (23%)
ZC504.1NP_001362150.1 KU 79..135 CDD:197529 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.