powered by:
Protein Alignment CG3604 and ZC504.1
DIOPT Version :9
Sequence 1: | NP_001285595.1 |
Gene: | CG3604 / 33593 |
FlyBaseID: | FBgn0031562 |
Length: | 132 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001362150.1 |
Gene: | ZC504.1 / 191192 |
WormBaseID: | WBGene00013916 |
Length: | 542 |
Species: | Caenorhabditis elegans |
Alignment Length: | 130 |
Identity: | 31/130 - (23%) |
Similarity: | 53/130 - (40%) |
Gaps: | 40/130 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 VVEKAEEPAVAKPLPDASELT-----VPED----------CHQPKET----------GRCF---- 65
:.||::: .|.|...|.::.: ||.. |.|.:|: |.||
Worm 34 IAEKSKD-GVIKWCEDTNDCSGGWKCVPSGQYHFSKQVNYCCQMRESICSMPPNPGYGDCFEEPR 97
Fly 66 ALFYRYAYNVDTQSCEEFVYGGCAG-NKNNFESKEQCEQACLVKSAVSSTDSTTEQNSEVATETS 129
.:||..:.:: .|::|....|.| |:|.||:.|.|.:.| .||.....|:..:|.::|
Worm 98 TMFYFDSLDL---KCKKFKVINCFGKNQNQFETYELCTRFC------QSTACLAGQSLLLARDSS 153
Fly 130 129
Worm 154 153
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG3604 | NP_001285595.1 |
KU |
53..106 |
CDD:238057 |
18/77 (23%) |
ZC504.1 | NP_001362150.1 |
KU |
79..135 |
CDD:197529 |
15/58 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.