DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3604 and C10G8.2

DIOPT Version :10

Sequence 1:NP_608801.1 Gene:CG3604 / 33593 FlyBaseID:FBgn0031562 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_504418.1 Gene:C10G8.2 / 182501 WormBaseID:WBGene00015681 Length:208 Species:Caenorhabditis elegans


Alignment Length:77 Identity:19/77 - (24%)
Similarity:33/77 - (42%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VVEKAEEPAVAKPLPDASELTVPEDCHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNN 94
            ::..|..|..:|.:.| |.||.  .|.:...        .::.::..|..|..|.:.||...:|.
 Worm    14 LIHGALSPRCSKSIFD-SNLTA--KCEKSST--------IKFHFDQSTGLCMNFRWDGCKDQENK 67

  Fly    95 FESKEQCEQACL 106
            |:|.::|...||
 Worm    68 FDSLQECASTCL 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3604NP_608801.1 Kunitz-type 55..105 CDD:438633 10/49 (20%)
C10G8.2NP_504418.1 Kunitz_BPTI <38..78 CDD:425421 9/47 (19%)

Return to query results.
Submit another query.